| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50064203 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158768 (CHEMBL772929) |
|---|
| Ki | 0.47±n/a nM |
|---|
| Citation |  Martin, SF; Dorsey, GO; Gane, T; Hillier, MC; Kessler, H; Baur, M; Mathä, B; Erickson, JW; Bhat, TN; Munshi, S; Gulnik, SV; Topol, IA Cyclopropane-derived peptidomimetics. Design, synthesis, evaluation, and structure of novel HIV-1 protease inhibitors. J Med Chem41:1581-97 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50064203 |
|---|
| n/a |
|---|
| Name | BDBM50064203 |
|---|
| Synonyms: | 1N-benzyl-2N-[1-benzyl-4-(2-benzylcarbamoyl-3-methylcyclopropylcarboxamido)-2,3-dihydroxy-5-phenyl-(1S,2R,3R,4S)-pentyl]-3-methyl-1,2-cyclopropanedicarboxamide | CHEMBL43518 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H50N4O6 |
|---|
| Mol. Mass. | 730.891 |
|---|
| SMILES | C[C@@H]1[C@H]([C@@H]1C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)[C@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1[C@H](C)[C@H]1C(=O)NCc1ccccc1)C(=O)NCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
