Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50064202
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158768
Ki 0.17±n/a nM
Citation Martin SFDorsey GOGane THillier MCKessler HBaur MMathä BErickson JWBhat TNMunshi SGulnik SVTopol IA Cyclopropane-derived peptidomimetics. Design, synthesis, evaluation, and structure of novel HIV-1 protease inhibitors. J Med Chem 41:1581-97 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064202
n/a
NameBDBM50064202
Synonyms:1N-benzyl-2N-[1-benzyl-4-(2-benzylcarbamoylcyclopropylcarboxamido)-2,3-dihydroxy-5-phenyl-(1S,2R,3R,4S)-pentyl]-1,2-cyclopropanedicarboxamide | CHEMBL287929
TypeSmall organic molecule
Emp. Form.C42H46N4O6
Mol. Mass.702.8378
SMILESO[C@@H]([C@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1C[C@H]1C(=O)NCc1ccccc1)[C@H](Cc1ccccc1)NC(=O)[C@@H]1C[C@H]1C(=O)NCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: