Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStromelysin-1
LigandBDBM50064339
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104745
Ki 24.1±n/a nM
Citation Xue CBHe XRoderick JDeGrado WFCherney RJHardman KDNelson DJCopeland RAJaffee BDDecicco CP Design and synthesis of cyclic inhibitors of matrix metalloproteinases and TNF-alpha production. J Med Chem 41:1745-8 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Stromelysin-1
Name:Matrix metalloproteinase (2 and 3)
Synonyms:MMP-3 | Matrix metalloproteinase 3 | Matrix metalloproteinase-3 | Matrix metalloproteinase-3 (MMP-3) | Matrix metalloproteinase-3 (MMP3) | SL-1 | Stromelysin 1 | Transin-1
Type:Enzyme
Mol. Mass.:53973.13
Organism:Homo sapiens (Human)
Description:
Residue:477
Sequence:
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064339
n/a
NameBDBM50064339
Synonyms:(9S,12R,13S)-12-Isobutyl-3,11-dioxo-1-oxa-4,10-diaza-cyclotridecane-9,13-dicarboxylic acid 13-hydroxyamide 9-methylamide | 12-Isobutyl-3,11-dioxo-1-oxa-4,10-diaza-cyclotridecane-9,13-dicarboxylic acid 13-hydroxyamide 9-methylamide (SC903) | CHEMBL48258
TypeSmall organic molecule
Emp. Form.C17H30N4O6
Mol. Mass.386.4433
SMILESCNC(=O)[C@@H]1CCCCNC(=O)CO[C@@H]([C@@H](CC(C)C)C(=O)N1)C(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: