| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50064515 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_149136 (CHEMBL759227) |
|---|
| Ki | 0.86±n/a nM |
|---|
| Citation |  Thomas, JB; Mascarella, SW; Rothman, RB; Partilla, JS; Xu, H; McCullough, KB; Dersch, CM; Cantrell, BE; Zimmerman, DM; Carroll, FI Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)piperidine opioid antagonists. J Med Chem41:1980-90 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM50064515 |
|---|
| n/a |
|---|
| Name | BDBM50064515 |
|---|
| Synonyms: | 3-[(3R,4R)-3,4-Dimethyl-1-((E)-3-o-tolyl-allyl)-piperidin-4-yl]-phenol | 3-[(3R,4R)-3,4-Dimethyl-1-(3-o-tolyl-allyl)-piperidin-4-yl]-phenol | 3-[3,4-Dimethyl-1-(3-o-tolyl-allyl)-piperidin-4-yl]-phenol | CHEMBL52451 | RTI-5989-25 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H29NO |
|---|
| Mol. Mass. | 335.4825 |
|---|
| SMILES | C[C@H]1CN(C\C=C\c2ccccc2C)CC[C@@]1(C)c1cccc(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
