Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50064593 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_157717 (CHEMBL763391) |
---|
Ki | 0.052±n/a nM |
---|
Citation | Han, Q; Chang, CH; Li, R; Ru, Y; Jadhav, PK; Lam, PY Cyclic HIV protease inhibitors: design and synthesis of orally bioavailable, pyrazole P2/P2' cyclic ureas with improved potency. J Med Chem41:2019-28 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50064593 |
---|
n/a |
---|
Name | BDBM50064593 |
Synonyms: | 3-{(4R,5S,6S,7R)-4,7-Dibenzyl-5,6-dihydroxy-2-oxo-3-[3-(2H-pyrazol-3-yl)-benzyl]-[1,3]diazepan-1-ylmethyl}-N-(2-morpholin-4-yl-ethyl)-benzamide | CHEMBL304713 |
Type | Small organic molecule |
Emp. Form. | C43H48N6O5 |
Mol. Mass. | 728.8784 |
SMILES | O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2cccc(c2)-c2cc[nH]n2)C(=O)N(Cc2cccc(c2)C(=O)NCCN2CCOCC2)[C@@H]1Cc1ccccc1 |
Structure |
|