| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM180 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157717 (CHEMBL763391) |
|---|
| Ki | 0.031±n/a nM |
|---|
| Citation |  Han, Q; Chang, CH; Li, R; Ru, Y; Jadhav, PK; Lam, PY Cyclic HIV protease inhibitors: design and synthesis of orally bioavailable, pyrazole P2/P2' cyclic ureas with improved potency. J Med Chem41:2019-28 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM180 |
|---|
| n/a |
|---|
| Name | BDBM180 |
|---|
| Synonyms: | (4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis({3-[1-(hydroxyimino)butyl]phenyl}methyl)-1,3-diazepan-2-one | CHEMBL292858 | Cyclic Urea |
|---|
| Type | n/a |
|---|
| Emp. Form. | C41H48N4O5 |
|---|
| Mol. Mass. | 676.8436 |
|---|
| SMILES | CCCC(N=O)c1cccc(CN2[C@H](Cc3ccccc3)[C@H](O)[C@@H](O)[C@@H](Cc3ccccc3)N(Cc3cccc(c3)C(CCC)N=O)C2=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
