Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutathione S-transferase kappa 1
LigandBDBM50064879
Substrate/Competitorn/a
Meas. Tech.ChEMBL_72308
IC50 10100±n/a nM
Citation Klotz PSlaoui-Hasnaoui ABanères JLDuckert JFRossi JCKerbal A Synthesis and glutathione S-transferase structure-affinity relationships of nonpeptide and peptidase-stable glutathione analogues. J Med Chem 41:2278-88 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutathione S-transferase kappa 1
Name:Glutathione S-transferase kappa 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:25502.12
Organism:Homo sapiens (Human)
Description:ChEMBL_72308
Residue:226
Sequence:
MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLP
RKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRE
LWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGA
FGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064879
n/a
NameBDBM50064879
Synonyms:5-Mercaptomethyl-decanedioic acid | CHEMBL73552
TypeSmall organic molecule
Emp. Form.C11H20O4S
Mol. Mass.248.339
SMILESOC(=O)CCCCC(CS)CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: