Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50064967 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_200965 (CHEMBL802053) |
---|
Ki | 2.89±n/a nM |
---|
Citation | Huang, Y; Hammond, PS; Whirrett, BR; Kuhner, RJ; Wu, L; Childers, SR; Mach, RH Synthesis and quantitative structure-activity relationships of N-(1-benzylpiperidin-4-yl)phenylacetamides and related analogues as potent and selective sigma1 receptor ligands. J Med Chem41:2361-70 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50064967 |
---|
n/a |
---|
Name | BDBM50064967 |
Synonyms: | CHEMBL431775 | N-(1-Benzyl-piperidin-4-yl)-2-(2-bromo-phenyl)-acetamide |
Type | Small organic molecule |
Emp. Form. | C20H23BrN2O |
Mol. Mass. | 387.313 |
SMILES | Brc1ccccc1CC(=O)NC1CCN(Cc2ccccc2)CC1 |
Structure |
|