| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50065073 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157733 (CHEMBL765171) |
|---|
| Ki | 0.04±n/a nM |
|---|
| Citation |  De Lucca, GV; Kim, UT; Liang, J; Cordova, B; Klabe, RM; Garber, S; Bacheler, LT; Lam, GN; Wright, MR; Logue, KA; Erickson-Viitanen, S; Ko, SS; Trainor, GL Nonsymmetric P2/P2' cyclic urea HIV protease inhibitors. Structure-activity relationship, bioavailability, and resistance profile of monoindazole-substituted P2 analogues. J Med Chem41:2411-23 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50065073 |
|---|
| n/a |
|---|
| Name | BDBM50065073 |
|---|
| Synonyms: | 3-[(4R,5S,6S,7R)-4,7-Dibenzyl-5,6-dihydroxy-3-(1H-indazol-5-ylmethyl)-2-oxo-[1,3]diazepan-1-ylmethyl]-N-(6-methyl-pyridin-2-yl)-benzamide | CHEMBL312030 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C41H40N6O4 |
|---|
| Mol. Mass. | 680.7941 |
|---|
| SMILES | Cc1cccc(NC(=O)c2cccc(CN3[C@H](Cc4ccccc4)[C@H](O)[C@@H](O)[C@@H](Cc4ccccc4)N(Cc4ccc5[nH]ncc5c4)C3=O)c2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
