Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50065140
Substrate/Competitorn/a
Meas. Tech.ChEMBL_200969
Ki 0.46±n/a nM
Citation John CSLim BBVilner BJGeyer BCBowen WD Substituted halogenated arylsulfonamides: a new class of sigma receptor binding tumor imaging agents. J Med Chem 41:2445-50 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065140
n/a
NameBDBM50065140
Synonyms:4-Iodo-N-(2-piperidin-1-yl-ethyl)-benzenesulfonamide | CHEMBL81500
TypeSmall organic molecule
Emp. Form.C13H19IN2O2S
Mol. Mass.394.272
SMILESIc1ccc(cc1)S(=O)(=O)NCCN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: