Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVascular endothelial growth factor receptor 1
LigandBDBM17015
Substrate/Competitorn/a
Meas. Tech.ChEMBL_214499
IC50 390±n/a nM
Citation Sun LTran NTang FApp HHirth PMcMahon GTang C Synthesis and biological evaluations of 3-substituted indolin-2-ones: a novel class of tyrosine kinase inhibitors that exhibit selectivity toward particular receptor tyrosine kinases. J Med Chem 41:2588-603 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vascular endothelial growth factor receptor 1
Name:Vascular endothelial growth factor receptor 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:149906.69
Organism:Mus musculus
Description:ChEMBL_820931
Residue:1333
Sequence:
MVSCWDTAVLPYALLGCLLLTGYGSGSKLKVPELSLKGTQHVMQAGQTLFLKCRGEAAHS
WSLPTTVSQEDKRLSITPPSACGRDNRQFCSTLTLDTAQANHTGLYTCRYLPTSTSKKKK
AESSIYIFVSDAGSPFIEMHTDIPKLVHMTEGRQLIIPCRVTSPNVTVTLKKFPFDTLTP
DGQRITWDSRRGFIIANATYKEIGLLNCEATVNGHLYQTNYLTHRQTNTILDVQIRPPSP
VRLLHGQTLVLNCTATTELNTRVQMSWNYPGKATKRASIRQRIDRSHSHNNVFHSVLKIN
NVESRDKGLYTCRVKSGSSFQSFNTSVHVYEKGFISVKHRKQPVQETTAGRRSYRLSMKV
KAFPSPEIVWLKDGSPATLKSARYLVHGYSLIIKDVTTEDAGDYTILLGIKQSRLFKNLT
ATLIVNVKPQIYEKSVSSLPSPPLYPLGSRQVLTCTVYGIPRPTITWLWHPCHHNHSKER
YDFCTENEESFILDPSSNLGNRIESISQRMTVIEGTNKTVSTLVVADSQTPGIYSCRAFN
KIGTVERNIKFYVTDVPNGFHVSLEKMPAEGEDLKLSCVVNKFLYRDITWILLRTVNNRT
MHHSISKQKMATTQDYSITLNLVIKNVSLEDSGTYACRARNIYTGEDILRKTEVLVRDSE
APHLLQNLSDYEVSISGSTTLDCQARGVPAPQITWFKNNHKIQQEPGIILGPGNSTLFIE
RVTEEDEGVYRCRATNQKGAVESAAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLF
IRKLKRSSSEVKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFG
KVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACT
KQGGPLMVIVEYCKYGNLSNYLKSKRDLFCLNKDAALHMELKKESLEPGLEQGQKPRLDS
VSSSSVTSSSFPEDRSVSDVEGDEDYSEISKQPLTMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRRGDTRLPLKWMAPESIFDKVYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLKEGMRMRTPEYATPEIYQIMLDCWHKD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPLNAILTRNSSFTYSTPTFSEDLFKDGFAD
PHFHSGSSDDVRYVNAFKFMSLERIKTFEELSPNSTSMFEDYQLDTSTLLGSPLLKRFTW
TETKPKASMKIDLRIASKSKEAGLSDLPRPSFCFSSCGHIRPVQDDESELGKESCCSPPP
DYNSVVLYSSPPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17015
n/a
NameBDBM17015
Synonyms:(3Z)-3-(1H-pyrrol-2-ylmethylidene)-2,3-dihydro-1H-indol-2-one | CHEMBL86755 | Indolinone based inhibitor, 1 | Oxindole I
TypeSmall organic molecule
Emp. Form.C13H10N2O
Mol. Mass.210.2313
SMILESO=C1Nc2ccccc2\C1=C\c1ccc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: