Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 2
LigandBDBM50065451
Substrate/Competitorn/a
Meas. Tech.ChEMBL_200368
Ki 2.3±n/a nM
Citation Tran TAMattern RHAfargan MAmitay OZiv OMorgan BATaylor JEHoyer DGoodman M Design, synthesis, and biological activities of potent and selective somatostatin analogues incorporating novel peptoid residues. J Med Chem 41:2679-85 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 2
Name:Somatostatin receptor type 2
Synonyms:SOMATOSTATIN SST2 | SRIF-1 | SS-2-R | SS2-R | SS2R | SSTR2 | Somatostatin receptor type 2 (SSTR2)
Type:Enzyme
Mol. Mass.:41344.94
Organism:Homo sapiens (Human)
Description:P30874
Residue:369
Sequence:
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065451
n/a
NameBDBM50065451
Synonyms:2-Amino-N-{4-[(2S,5S,8S,14S,17R)-8,14-dibenzyl-5-((R)-1-hydroxy-ethyl)-17-(1H-indol-3-ylmethyl)-3,6,9,12,15,18-hexaoxo-10-((R)-1-phenyl-ethyl)-1,4,7,10,13,16hexaaza-cyclooctadec-2-yl]-butyl}-3-phenyl-propionamide | CHEMBL2370167
TypeSmall organic molecule
Emp. Form.C58H67N9O8
Mol. Mass.1018.2081
SMILES[H][C@]1(NC(=O)[C@H](CCCCNC(=O)[C@@H](N)Cc2ccccc2)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)CN([C@H](C)c2ccccc2)C(=O)[C@H](Cc2ccccc2)NC1=O)[C@@H](C)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: