Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM50065899 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_34105 (CHEMBL649734) |
---|
IC50 | 2200±n/a nM |
---|
Citation | Yoakim, C; Ogilvie, WW; Cameron, DR; Chabot, C; Guse, I; Haché, B; Naud, J; O'Meara, JA; Plante, R; Déziel, R beta-Lactam derivatives as inhibitors of human cytomegalovirus protease. J Med Chem41:2882-91 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM50065899 |
---|
n/a |
---|
Name | BDBM50065899 |
Synonyms: | (2S,3S)-2-Benzyl-3-methylsulfanyl-4-oxo-azetidine-1-carboxylic acid (pyridin-4-ylmethyl)-amide | CHEMBL95260 |
Type | Small organic molecule |
Emp. Form. | C18H19N3O2S |
Mol. Mass. | 341.427 |
SMILES | CS[C@H]1[C@H](Cc2ccccc2)N(C(=O)NCc2ccncc2)C1=O |
Structure |
|