| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50066337 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_212874 (CHEMBL817824) |
|---|
| Ki | 7000±n/a nM |
|---|
| Citation |  Tucker, TJ; Brady, SF; Lumma, WC; Lewis, SD; Gardell, SJ; Naylor-Olsen, AM; Yan, Y; Sisko, JT; Stauffer, KJ; Lucas, BJ; Lynch, JJ; Cook, JJ; Stranieri, MT; Holahan, MA; Lyle, EA; Baskin, EP; Chen, IW; Dancheck, KB; Krueger, JA; Cooper, CM; Vacca, JP Design and synthesis of a series of potent and orally bioavailable noncovalent thrombin inhibitors that utilize nonbasic groups in the P1 position. J Med Chem41:3210-9 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM50066337 |
|---|
| n/a |
|---|
| Name | BDBM50066337 |
|---|
| Synonyms: | (S)-1-(2-Amino-3,3-diphenyl-propionyl)-pyrrolidine-2-carboxylic acid 2,5-dichloro-benzylamide | CHEMBL108183 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H27Cl2N3O2 |
|---|
| Mol. Mass. | 496.428 |
|---|
| SMILES | NC(C(c1ccccc1)c1ccccc1)C(=O)N1CCC[C@H]1C(=O)NCc1cc(Cl)ccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
