| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50066331 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_49753 (CHEMBL662085) |
|---|
| Ki | 174000±n/a nM |
|---|
| Citation |  Tucker, TJ; Brady, SF; Lumma, WC; Lewis, SD; Gardell, SJ; Naylor-Olsen, AM; Yan, Y; Sisko, JT; Stauffer, KJ; Lucas, BJ; Lynch, JJ; Cook, JJ; Stranieri, MT; Holahan, MA; Lyle, EA; Baskin, EP; Chen, IW; Dancheck, KB; Krueger, JA; Cooper, CM; Vacca, JP Design and synthesis of a series of potent and orally bioavailable noncovalent thrombin inhibitors that utilize nonbasic groups in the P1 position. J Med Chem41:3210-9 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50066331 |
|---|
| n/a |
|---|
| Name | BDBM50066331 |
|---|
| Synonyms: | (S)-1-[(R)-2-Cyclohexyl-2-(diethylcarbamoylmethyl-amino)-acetyl]-pyrrolidine-2-carboxylic acid 2,5-dichloro-benzylamide | CHEMBL441468 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H38Cl2N4O3 |
|---|
| Mol. Mass. | 525.511 |
|---|
| SMILES | CCN(CC)C(=O)CN[C@H](C1CCCCC1)C(=O)N1CCC[C@H]1C(=O)NCc1cc(Cl)ccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
