Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptidyl-prolyl cis-trans isomerase FKBP1A
LigandBDBM50067004
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195890
Ki 17±n/a nM
Citation Lamb MLJorgensen WL Investigations of neurotrophic inhibitors of FK506 binding protein via Monte Carlo simulations. J Med Chem 41:3928-39 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptidyl-prolyl cis-trans isomerase FKBP1A
Name:Peptidyl-prolyl cis-trans isomerase FKBP1A
Synonyms:12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKBP-12 | FKBP-1A | FKBP12 | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase
Type:Isomerase
Mol. Mass.:11953.09
Organism:Homo sapiens (Human)
Description:P62942
Residue:108
Sequence:
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50067004
n/a
NameBDBM50067004
Synonyms:(S)-1-(3,3-Dimethyl-2-oxo-pentanoyl)-piperidine-2-carboxylic acid (R)-1,3-diphenyl-propyl ester | 1,3-DIPHENYL-1-PROPYL-1-(3,3-DIMETHYL-1,2-DIOXYPENTYL)-2-PIPERIDINE CARBOXYLATE | CHEMBL126568
TypeSmall organic molecule
Emp. Form.C28H35NO4
Mol. Mass.449.5818
SMILESCCC(C)(C)C(=O)C(=O)N1CCCC[C@H]1C(=O)O[C@H](CCc1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: