Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50067447
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145301
Ki 0.34±n/a nM
Citation Thomas JBZheng XMascarella SWRothman RBDersch CMPartilla JSFlippen-Anderson JLGeorge CFCantrell BEZimmerman DMCarroll FI N-Substituted 9beta-methyl-5-(3-hydroxyphenyl)morphans are opioid receptor pure antagonists. J Med Chem 41:4143-9 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50067447
n/a
NameBDBM50067447
Synonyms:3-((R)-9-Methyl-2-phenethyl-2-aza-bicyclo[3.3.1]non-5-yl)-phenol | CHEMBL334898
TypeSmall organic molecule
Emp. Form.C23H29NO
Mol. Mass.335.4825
SMILESC[C@H]1C2CCCC1(CCN2CCc1ccccc1)c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: