| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1D |
|---|
| Ligand | BDBM50068840 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_32426 (CHEMBL646088) |
|---|
| Ki | 4570±n/a nM |
|---|
| Citation |  Nagarathnam, D; Wetzel, JM; Miao, SW; Marzabadi, MR; Chiu, G; Wong, WC; Hong, X; Fang, J; Forray, C; Branchek, TA; Heydorn, WE; Chang, RS; Broten, T; Schorn, TW; Gluchowski, C Design and synthesis of novel alpha1a adrenoceptor-selective dihydropyridine antagonists for the treatment of benign prostatic hyperplasia. J Med Chem41:5320-33 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1D |
|---|
| Name: | 5-hydroxytryptamine receptor 1D |
|---|
| Synonyms: | 5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | 5HT1D_HUMAN | HTR1D | HTR1DA | HTRL | Serotonin (5-HT) receptor | Serotonin Receptor 1D |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41920.63 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells. |
|---|
| Residue: | 377 |
|---|
| Sequence: | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
|
|
|
|---|
| BDBM50068840 |
|---|
| n/a |
|---|
| Name | BDBM50068840 |
|---|
| Synonyms: | 1-{3-[(4-Benzo[1,3]dioxol-5-yl-5-carbamoyl-2,6-dimethyl-1,4-dihydro-pyridine-3-carbonyl)-amino]-propyl}-4-phenyl-piperidine-4-carboxylic acid ethyl ester | CHEMBL149263 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H40N4O6 |
|---|
| Mol. Mass. | 588.6939 |
|---|
| SMILES | CCOC(=O)C1(CCN(CCCNC(=O)C2=C(C)N=C(C)C(C2c2ccc3OCOc3c2)C(N)=O)CC1)c1ccccc1 |c:15,t:18| |
|---|
| Structure | 
|
|---|
Search and Browse
