Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor
LigandBDBM50215372
Substrate/Competitorn/a
Meas. Tech.ChEMBL_99997
IC50 1.4±n/a nM
Citation von Sprecher AGerspacher MBeck AKimmel SWiestner HAnderson GPNiederhauser USubramanian NBray MA Synthesis and SAR of a novel, potent and structurally simple LTD4 antagonist of the quinoline class. Bioorg Med Chem Lett 8:965-70 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor
Name:Cysteinyl leukotriene receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 98640
Components:This complex has 2 components.
Component 1
Name:Cysteinyl leukotriene receptor
Synonyms:CYSLTR1 | Cysteinyl leukotriene D4 receptor | Cysteinyl leukotriene receptor | HG55 | HMTMF81 | LTD4 receptor | Leukotriene Cysteinyl 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38565.16
Organism:Homo sapiens (Human)
Description:Leukotriene Cysteinyl 1 CYSLTR1 HUMAN::Q9Y271
Residue:337
Sequence:
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cysteinyl leukotriene receptor
Synonyms:Cysteinyl leukotriene receptor 2 | Leukotriene Cysteinyl 2
Type:Enzyme Catalytic Domain
Mol. Mass.:39657.52
Organism:Homo sapiens (Human)
Description:Leukotriene Cysteinyl 2 CYSLTR2 HUMAN::Q9NS75
Residue:346
Sequence:
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF
NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50215372
n/a
NameBDBM50215372
Synonyms:CHEMBL175419
TypeSmall organic molecule
Emp. Form.C22H21FN2O4
Mol. Mass.396.4115
SMILESCC(C)(CC(=O)Nc1cccc(OCc2ccc3ccc(F)cc3n2)c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: