| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM161 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_80093 (CHEMBL687817) |
|---|
| Ki | 0.018000±n/a nM |
|---|
| Citation |  Rodgers, JD; Johnson, BL; Wang, H; Erickson-Viitanen, S; Klabe, RM; Bacheler, L; Cordova, BC; Chang, CH Potent cyclic urea HIV protease inhibitors with 3-aminoindazole P2/P2' groups. Bioorg Med Chem Lett8:715-20 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM161 |
|---|
| n/a |
|---|
| Name | BDBM161 |
|---|
| Synonyms: | (4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis(1H-indazol-5-ylmethyl)-1,3-diazepan-2-one | CHEMBL78671 | Cyclic Urea | Indazole, 1 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C35H34N6O3 |
|---|
| Mol. Mass. | 586.6829 |
|---|
| SMILES | O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2ccc3[nH]ncc3c2)C(=O)N(Cc2ccc3[nH]ncc3c2)[C@@H]1Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
