| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50069199 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_80092 |
|---|
| Ki | 0.059000±n/a nM |
|---|
| Citation |  Patel, M; Bacheler, LT; Rayner, MM; Cordova, BC; Klabe, RM; Erickson-Viitanen, S; Seitz, SP The synthesis and evaluation of cyclic ureas as HIV protease inhibitors: modifications of the P1/P1' residues. Bioorg Med Chem Lett8:823-8 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50069199 |
|---|
| n/a |
|---|
| Name | BDBM50069199 |
|---|
| Synonyms: | (4R,5S,6S,7R)-5,6-Dihydroxy-4,7-bis-[4-(2-hydroxy-ethoxy)-benzyl]-1,3-bis-[3-(1H-pyrazol-3-yl)-benzyl]-[1,3]diazepan-2-one | CHEMBL446691 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C43H46N6O7 |
|---|
| Mol. Mass. | 758.8613 |
|---|
| SMILES | OCCOc1ccc(C[C@@H]2[C@H](O)[C@@H](O)[C@@H](Cc3ccc(OCCO)cc3)N(Cc3cccc(c3)-c3cc[nH]n3)C(=O)N2Cc2cccc(c2)-c2cc[nH]n2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
