| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50069558 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_147163 |
|---|
| Ki | 5.2±n/a nM |
|---|
| Citation |  Li, G; Haq, W; Xiang, L; Lou, BS; Hughes, R; De Leon, IA; Davis, P; Gillespie, TJ; Romanowski, M; Zhu, X; Misicka, A; Lipkowski, AW; Porreca, F; Davis, TP; Yamamura, HI; O'Brien, DF; Hruby, VJ Modifications of the 4,4'-residues and SAR studies of Biphalin, a highly potent opioid receptor active peptide. Bioorg Med Chem Lett8:555-60 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50069558 |
|---|
| n/a |
|---|
| Name | BDBM50069558 |
|---|
| Synonyms: | 2-Amino-N-((S)-1-{[(2-{N'-[2-(2-{(S)-2-[2-amino-3-(4-hydroxy-phenyl)-propionylamino]-propionylamino}-acetylamino)-3-phenyl-propionyl]-hydrazino}-1-benzyl-2-oxo-ethylcarbamoyl)-methyl]-carbamoyl}-ethyl)-3-(4-hydroxy-phenyl)-propionamide | CHEMBL2371056 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C46H56N10O10 |
|---|
| Mol. Mass. | 908.9978 |
|---|
| SMILES | C[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)NNC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
