Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50069559 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_138747 |
---|
IC50 | 1.7±n/a nM |
---|
Citation | Li, G; Haq, W; Xiang, L; Lou, BS; Hughes, R; De Leon, IA; Davis, P; Gillespie, TJ; Romanowski, M; Zhu, X; Misicka, A; Lipkowski, AW; Porreca, F; Davis, TP; Yamamura, HI; O'Brien, DF; Hruby, VJ Modifications of the 4,4'-residues and SAR studies of Biphalin, a highly potent opioid receptor active peptide. Bioorg Med Chem Lett8:555-60 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50069559 |
---|
n/a |
---|
Name | BDBM50069559 |
Synonyms: | Biphalin Analogue | CHEMBL2371057 |
Type | Small organic molecule |
Emp. Form. | C54H60N10O10 |
Mol. Mass. | 1009.1152 |
SMILES | C[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](Cc1cccc2ccccc12)C(=O)NNC(=O)[C@H](Cc1cccc2ccccc12)NC(=O)CNC(=O)[C@@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1 |
Structure |
|