| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50069562 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_138747 |
|---|
| IC50 | 21±n/a nM |
|---|
| Citation |  Li, G; Haq, W; Xiang, L; Lou, BS; Hughes, R; De Leon, IA; Davis, P; Gillespie, TJ; Romanowski, M; Zhu, X; Misicka, A; Lipkowski, AW; Porreca, F; Davis, TP; Yamamura, HI; O'Brien, DF; Hruby, VJ Modifications of the 4,4'-residues and SAR studies of Biphalin, a highly potent opioid receptor active peptide. Bioorg Med Chem Lett8:555-60 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50069562 |
|---|
| n/a |
|---|
| Name | BDBM50069562 |
|---|
| Synonyms: | 2-Amino-N-((S)-1-{[((R)-1-{N'-[(R)-2-(2-{(S)-2-[2-amino-3-(4-hydroxy-phenyl)-propionylamino]-propionylamino}-acetylamino)-3-phenyl-butyryl]-hydrazinocarbonyl}-2-phenyl-propylcarbamoyl)-methyl]-carbamoyl}-ethyl)-3-(4-hydroxy-phenyl)-propionamide | CHEMBL2371082 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C48H60N10O10 |
|---|
| Mol. Mass. | 937.051 |
|---|
| SMILES | C[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H]([C@H](C)c1ccccc1)C(=O)NNC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@H](C)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
