Reaction Details |
| Report a problem with these data |
Target | Low affinity immunoglobulin epsilon Fc receptor |
---|
Ligand | BDBM50069613 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_41669 |
---|
IC50 | 130±n/a nM |
---|
Citation | Bailey, S; Bolognese, B; Buckle, DR; Faller, A; Jackson, S; Louis-Flamberg, P; McCord, M; Mayer, RJ; Marshall, LA; Smith, DG Selective inhibition of low affinity IgE receptor (CD23) processing. Bioorg Med Chem Lett8:29-34 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Low affinity immunoglobulin epsilon Fc receptor |
---|
Name: | Low affinity immunoglobulin epsilon Fc receptor |
Synonyms: | BLAST-2 | CD23A | CD_antigen=CD23 | CLEC4J | FCE2 | FCER2 | FCER2_HUMAN | Fc-epsilon-RII | IGEBF | Immunoglobulin E-binding factor | Immunoglobulin epsilon Fc receptor | Low affinity immunoglobulin epsilon Fc receptor | Low affinity immunoglobulin epsilon Fc receptor membrane-bound form | Low affinity immunoglobulin epsilon Fc receptor soluble form | Lymphocyte IgE receptor |
Type: | PROTEIN |
Mol. Mass.: | 36461.84 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_88888 |
Residue: | 321 |
Sequence: | MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS
|
|
|
BDBM50069613 |
---|
n/a |
---|
Name | BDBM50069613 |
Synonyms: | (2R,3S)-N*1*-((S)-1-Carbamoyl-2-phenyl-ethyl)-N*4*-hydroxy-2-isobutyl-3-mercaptomethyl-succinamide | CHEMBL324723 |
Type | Small organic molecule |
Emp. Form. | C18H27N3O4S |
Mol. Mass. | 381.49 |
SMILES | CC(C)C[C@H]([C@H](CS)C(=O)NO)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |
Structure |
|