| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen B |
|---|
| Ligand | BDBM50069989 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_49748 (CHEMBL662080) |
|---|
| Ki | 320±n/a nM |
|---|
| Citation |  Adams, J; Behnke, M; Chen, S; Cruickshank, AA; Dick, LR; Grenier, L; Klunder, JM; Ma, YT; Plamondon, L; Stein, RL Potent and selective inhibitors of the proteasome: dipeptidyl boronic acids. Bioorg Med Chem Lett8:333-8 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen B |
|---|
| Name: | Chymotrypsinogen B |
|---|
| Synonyms: | Beta-chymotrypsin | CTRB | CTRB1 | CTRB1_HUMAN | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B | Synonyms=CTRB |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27713.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_10909 |
|---|
| Residue: | 263 |
|---|
| Sequence: | MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
|
|
|
|---|
| BDBM50069989 |
|---|
| n/a |
|---|
| Name | BDBM50069989 |
|---|
| Synonyms: | (R)-3-methyl-1-((S)-3-phenyl-2-(pyrazine-2-carboxamido)propanamido)butylboronic acid | (R)-3-methyl-1-((S)-3-phenyl-2-(pyrazine-6-carboxamido)propanamido)butylboronic acid | BORTEZOMIB | CHEMBL325041 | Dipeptidyl boronic acid derivative | LDP-341 | N-[(1R)-1-(DIHYDROXYBORYL)-3-METHYLBUTYL]-N-(PYRAZIN-2-YLCARBONYL)-L-PHENYLALANINAMIDE | PS-341 | Peptidyl boronic acid derivative | US11542283, Compound Velcade | Velcade | cid_387447 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H25BN4O4 |
|---|
| Mol. Mass. | 384.237 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)c1cnccn1)B(O)O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
