Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase
LigandBDBM50071541
Substrate/Competitorn/a
Meas. Tech.ChEMBL_141001
Ki 4500±n/a nM
Citation Warmus JSRyder TRHodges JCKennedy RMBrady KD Rapid optimization of an ICE inhibitor synthesis using multiple reaction conditions in a parallel array. Bioorg Med Chem Lett 8:2309-14 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Caspase
Name:Caspase
Synonyms:Caspase 1 | ICE | Interleukin-1 beta convertase | Interleukin-1 beta-converting enzyme
Type:Enzyme
Mol. Mass.:45154.13
Organism:Homo sapiens (Human)
Description:P29466
Residue:404
Sequence:
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071541
n/a
NameBDBM50071541
Synonyms:(S)-3-(benzyloxycarbonylamino)-4-oxo-5-(3-phenylpropanoyloxy)pentanoic acid | (S)-3-Benzyloxycarbonylamino-4-oxo-5-(3-phenyl-propionyloxy)-pentanoic acid | CHEMBL73653
TypeSmall organic molecule
Emp. Form.C22H23NO7
Mol. Mass.413.4205
SMILESOC(=O)C[C@H](NC(=O)OCc1ccccc1)C(=O)COC(=O)CCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: