| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50071619 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159306 |
|---|
| IC50 | 10±n/a nM |
|---|
| Citation |  Ro, S; Baek, SG; Lee, B; Park, C; Choy, N; Lee, CS; Son, YC; Choi, H; Koh, JS; Yoon, H; Kim, SC; Ok, JH NMR and topochemical studies of peptidomimetic HIV-I protease inhibitors containing a cis-epoxide amide isostere. Bioorg Med Chem Lett8:2423-6 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50071619 |
|---|
| n/a |
|---|
| Name | BDBM50071619 |
|---|
| Synonyms: | (S)-N*1*-((S)-1-{(2R,3S)-3-[((R)-1-Methoxycarbamoyl-2-methyl-propylcarbamoyl)-methyl]-oxiranyl}-2-phenyl-ethyl)-2-[(quinoline-2-carbonyl)-amino]-succinamide | CHEMBL78312 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H38N6O7 |
|---|
| Mol. Mass. | 618.6801 |
|---|
| SMILES | CONC(=O)[C@H](NC(=O)C[C@@H]1O[C@@H]1[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)c1ccc2ccccc2n1)C(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
