Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1D adrenergic receptor
LigandBDBM50071647
Substrate/Competitorn/a
Meas. Tech.ChEBML_33019
Ki 85±n/a nM
Citation Nerenberg JBErb JMThompson WJLee HYGuare JPMunson PMBergman JMHuff JRBroten TPChang RSChen TBO'Malley SSchorn TWScott AL Design and synthesis of N-alkylated saccharins as selective alpha-1a adrenergic receptor antagonists. Bioorg Med Chem Lett 8:2467-72 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-1D adrenergic receptor
Name:Alpha adrenergic receptor (1a and 1d)
Synonyms:ADRA1A | ADRA1D | Adrenergic receptor alpha | Alpha 1D-adrenoceptor | Alpha 1D-adrenoreceptor | Alpha-1D adrenoceptor | Alpha-adrenergic receptor 1a | adrenergic Alpha1D
Type:Enzyme Catalytic Domain
Mol. Mass.:60485.82
Organism:Homo sapiens (Human)
Description:adrenergic Alpha1D ADRA1D HUMAN::P25100
Residue:572
Sequence:
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071647
n/a
NameBDBM50071647
Synonyms:3-{1-[4-(5-Chloro-1,1,3-trioxo-1,3-dihydro-1lambda*6*-benzo[d]isothiazol-2-yl)-butyl]-piperidin-4-yl}-3H-benzooxazol-2-one | CHEMBL313990
TypeSmall organic molecule
Emp. Form.C23H24ClN3O5S
Mol. Mass.489.972
SMILESClc1ccc2c(c1)C(=O)N(CCCCN1CCC(CC1)n1c3ccccc3oc1=O)S2(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: