Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepatitis C virus serine protease, NS3/NS4A
LigandBDBM50071968
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143630
IC50 640±n/a nM
Citation Llinàs-Brunet MBailey MDéziel RFazal GGorys VGoulet SHalmos TMaurice RPoirier MPoupart MARancourt JThibeault DWernic DLamarre D Studies on the C-terminal of hexapeptide inhibitors of the hepatitis C virus serine protease. Bioorg Med Chem Lett 8:2719-24 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Hepatitis C virus serine protease, NS3/NS4A
Name:Hepatitis C virus serine protease, NS3/NS4A
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 143634
Components:This complex has 2 components.
Component 1
Name:Hepatitis C virus serine protease, NS3/NS4A
Synonyms:Hepatitis C virus NS3 protease/helicase
Type:Protein
Mol. Mass.:67067.41
Organism:Hepatitis C virus
Description:A3EZI9
Residue:631
Sequence:
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTAAQTFLATCINGVCWTVYHGAG
TRTIASSKGPVIQMYTNVDQDLVGWPAPQGARSLTPCTCGSSDLYLVTRHADVIPVRRRG
DGRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVEGLETTMR
SPVFSDNSSPPAVPQSYQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGA
YMSKAHGIDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSI
LGIGTVLDQAETAGARLTVLATATPPGSVTVPHPNIEEVALSTTGEIPFYGKAIPLEAIK
GGRHLIFCHSKKKCDELAAKLVALGVNAVAYYRGLDVSVIPASGDVVVVATDALMTGFTG
DFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVTPGE
RPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLT
HIDAHFLSQTKQSGENLPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLY
RLGAVQNEITLTHPITKYIMTCMSADLEVVT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Hepatitis C virus serine protease, NS3/NS4A
Synonyms:Hepatitis C virus NS4A protein | Non-structural protein 4A
Type:PROTEIN
Mol. Mass.:5762.65
Organism:Hepatitis C virus
Description:ChEMBL_305334
Residue:54
Sequence:
STWVLLGGVLAALAAYCLSVGCVVIVGYIELGGKPALVPDKEVCYQQYDEMEEC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071968
n/a
NameBDBM50071968
Synonyms:(S)-3-((S)-2-Acetylamino-3-carboxy-propionylamino)-N-((1S,2S)-1-{(S)-1-[2-((S)-1-benzylaminooxalyl-butylcarbamoyl)-pyrrolidine-1-carbonyl]-2-methyl-propylcarbamoyl}-2-methyl-butyl)-succinamic acid | CHEMBL2370184
TypeSmall organic molecule
Emp. Form.C39H57N7O12
Mol. Mass.815.9096
SMILESCCC[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(C)=O)[C@@H](C)CC)C(C)C)C(=O)C(=O)NCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: