Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 4
LigandBDBM50072205
Substrate/Competitorn/a
Meas. Tech.ChEBML_155172
IC50 600±n/a nM
Citation Charpiot BBrun JDonze INaef RStefani MMueller T Quinazolines: combined type 3 and 4 phosphodiesterase inhibitors. Bioorg Med Chem Lett 8:2891-6 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 4
Name:Phosphodiesterase 4
Synonyms:Phosphodiesterase 4B | cAMP-specific 3'',5''-cyclic phosphodiesterase 4B
Type:Enzyme Catalytic Domain
Mol. Mass.:83349.50
Organism:RAT
Description:Phosphodiesterase 4 0 RAT::P14646
Residue:736
Sequence:
MKKSRSVMAVTADDNLKDYFECSLSKSYSSSSYTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSSGLVL
HAAFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRIVR
NNFTLLTNLHGAPNKRSPAASQAPVTRVSLQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDERSRDCQGLMEKFQFELTLEEEDSEGPEKEGEGPNYFSSTKTLCVIDPENRDSLE
ETDIDIATEDKSLIDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072205
n/a
NameBDBM50072205
Synonyms:4-(3,5-Bis-cyclopropylmethoxy-phenyl)-7-cyclopropylmethoxy-2-ethyl-6-methoxy-quinazoline | CHEMBL97866
TypeSmall organic molecule
Emp. Form.C29H34N2O4
Mol. Mass.474.5913
SMILESCCc1nc(-c2cc(OCC3CC3)cc(OCC3CC3)c2)c2cc(OC)c(OCC3CC3)cc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: