| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melatonin receptor type 1B |
|---|
| Ligand | BDBM9019 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_219514 |
|---|
| Ki | 0.700000±n/a nM |
|---|
| Citation |  Kloubert, S; Mathé-Allainmat, M; Andrieux, J; Sicsic, S; Langlois, M Synthesis of benzocycloalkane derivatives as new conformationally restricted ligands for melatonin receptors. Bioorg Med Chem Lett8:3325-30 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melatonin receptor type 1B |
|---|
| Name: | Melatonin receptor type 1B |
|---|
| Synonyms: | MEL-1B-R | MTR1B_CHICK | Melatonin | Melatonin receptor | Melatonin receptor type 1B |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 33012.73 |
|---|
| Organism: | Chick |
|---|
| Description: | Melatonin 0 Chick::P51050 |
|---|
| Residue: | 289 |
|---|
| Sequence: | GNAFVVSLALADLVVALYPYPLVLLAIFHNGWTLGEMHCKVSGFVMGLSVIGSIFNITAI
AINRYCYICHSFAYDKVYSCWNTMLYVSLIWVLTVIATVPNFFVGSLKYDPRIYSCTFVQ
TASSYYTIAVVVIHFIVPITVVSFCYLRIWVLVLQVRRRVKSETKPRLKPSDFRNFLTMF
VVFVIFAFCWAPLNFIGLAVAINPSEMAPKVPEWLFIISYFMAYFNSCLNAIIYGLLNQN
FRNEYKRILMSLWMPRLFFQDTSKGGTDGQKSKPSPALNNNDQMKTDTL
|
|
|
|---|
| BDBM9019 |
|---|
| n/a |
|---|
| Name | BDBM9019 |
|---|
| Synonyms: | CHEMBL45 | Melatonin | N-[2-(5-methoxy-1H-indol-3-yl)ethyl]acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H16N2O2 |
|---|
| Mol. Mass. | 232.2783 |
|---|
| SMILES | COc1ccc2[nH]cc(CCNC(C)=O)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
