Reaction Details |
| Report a problem with these data |
Target | Melatonin receptor type 1B |
---|
Ligand | BDBM50072658 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_219514 |
---|
Ki | 40±n/a nM |
---|
Citation | Kloubert, S; Mathé-Allainmat, M; Andrieux, J; Sicsic, S; Langlois, M Synthesis of benzocycloalkane derivatives as new conformationally restricted ligands for melatonin receptors. Bioorg Med Chem Lett8:3325-30 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melatonin receptor type 1B |
---|
Name: | Melatonin receptor type 1B |
Synonyms: | MEL-1B-R | MTR1B_CHICK | Melatonin | Melatonin receptor | Melatonin receptor type 1B |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 33012.73 |
Organism: | Chick |
Description: | Melatonin 0 Chick::P51050 |
Residue: | 289 |
Sequence: | GNAFVVSLALADLVVALYPYPLVLLAIFHNGWTLGEMHCKVSGFVMGLSVIGSIFNITAI
AINRYCYICHSFAYDKVYSCWNTMLYVSLIWVLTVIATVPNFFVGSLKYDPRIYSCTFVQ
TASSYYTIAVVVIHFIVPITVVSFCYLRIWVLVLQVRRRVKSETKPRLKPSDFRNFLTMF
VVFVIFAFCWAPLNFIGLAVAINPSEMAPKVPEWLFIISYFMAYFNSCLNAIIYGLLNQN
FRNEYKRILMSLWMPRLFFQDTSKGGTDGQKSKPSPALNNNDQMKTDTL
|
|
|
BDBM50072658 |
---|
n/a |
---|
Name | BDBM50072658 |
Synonyms: | CHEMBL114929 | N-(4-Methoxy-bicyclo[4.2.0]octa-1,3,5-trien-7-ylmethyl)-propionamide |
Type | Small organic molecule |
Emp. Form. | C13H17NO2 |
Mol. Mass. | 219.2796 |
SMILES | CCC(=O)NCC1Cc2ccc(OC)cc12 |
Structure |
|