Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50060601
Substrate/Competitorn/a
Meas. Tech.ChEMBL_58610
Ki 0.06±n/a nM
Citation Khalil EMOjala WHPradhan ANair VDGleason WBMishra RKJohnson RL Design, synthesis, and dopamine receptor modulating activity of spiro bicyclic peptidomimetics of L-prolyl-L-leucyl-glycinamide. J Med Chem 42:628-37 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:Dopamine receptor D2L/neurotensin receptor NTS1
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060601
n/a
NameBDBM50060601
Synonyms:(E)-6-(3-oxo-3-phenylprop-1-enyl)pyrimidine-2,4(1H,3H)-dione | (S)-Pyrrolidine-2-carboxylic acid [(S)-1-(carbamoylmethyl-carbamoyl)-3-methyl-butyl]-amide | 6-((E)-3-Oxo-3-phenyl-propenyl)-1H-pyrimidine-2,4-dione | CHEMBL317488 | L-pro-L-leu-gly-NH2 | L-prolyl-L-leucylglycinamide | Pyrrolidine-2-carboxylic acid [1-(carbamoylmethyl-carbamoyl)-3-methyl-butyl]-amide
TypeSmall organic molecule
Emp. Form.C13H24N4O3
Mol. Mass.284.3547
SMILESCC(C)C[C@H](NC(=O)[C@@H]1CCCN1)C(=O)NCC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: