Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCorticotropin releasing factor receptor 1
LigandBDBM50074486
Substrate/Competitorn/a
Meas. Tech.ChEMBL_51114
Ki 7.4±n/a nM
Citation Chorvat RJBakthavatchalam RBeck JPGilligan PJWilde RGCocuzza AJHobbs FWCheeseman RSCurry MRescinito JPKrenitsky PChidester DYarem JAKlaczkiewicz JDHodge CNAldrich PEWasserman ZRFernandez CHZaczek RFitzgerald LWHuang SMShen HLWong YNChien BMArvanitis A Synthesis, corticotropin-releasing factor receptor binding affinity, and pharmacokinetic properties of triazolo-, imidazo-, and pyrrolopyrimidines and -pyridines. J Med Chem 42:833-48 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Corticotropin releasing factor receptor 1
Name:Corticotropin releasing factor receptor 1
Synonyms:CRF-R | CRF-R2 Alpha | CRF1 | CRH-R 1 | CRHR1 | Corticotropin-releasing factor receptor 1 (CRF-1) | Corticotropin-releasing factor receptor 1 (CRF1) | Corticotropin-releasing hormone receptor 1
Type:Enzyme
Mol. Mass.:50744.31
Organism:Homo sapiens (Human)
Description:P34998
Residue:444
Sequence:
MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074486
n/a
NameBDBM50074486
Synonyms:CHEMBL169955 | [3-(2,4-Dibromo-phenyl)-5-methyl-3H-[1,2,3]triazolo[4,5-d]pyrimidin-7-yl]-bis-(2-methoxy-ethyl)-amine
TypeSmall organic molecule
Emp. Form.C17H20Br2N6O2
Mol. Mass.500.188
SMILESCOCCN(CCOC)c1nc(C)nc2n(nnc12)-c1ccc(Br)cc1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: