Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxypeptidase G2
LigandBDBM50074673
Substrate/Competitorn/a
Meas. Tech.ChEMBL_45646
Ki 2500±n/a nM
Citation Khan THEno-Amooquaye EASearle FBrowne PJOsborn HMBurke PJ Novel inhibitors of carboxypeptidase G2 (CPG2): potential use in antibody-directed enzyme prodrug therapy. J Med Chem 42:951-6 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carboxypeptidase G2
Name:Carboxypeptidase G2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:44005.37
Organism:Pseudomonas aeruginosa
Description:ChEMBL_302801
Residue:412
Sequence:
MHARRLPRLLPLALAFLLSPAAFAADTPAAELLRQAEAERPAYLDTLRQLVAVDSGTGQA
EGLGQLSALLAERLQALGAQVRSAPATPSAGDNLVATLDGTGSKRFLLMIHYDTVFAAGS
AAKRPFREDAERAYGPGVADAKGGVAMVLHALALLRQQGFRDYGRITVLFNPDEETGSAG
SKQLIAELARQQDYVFSYEPPDRDAVTVATNGIDGLLLEVKGRSSHAGSAPEQGRNAILE
LSHQLLRLKDLGDPAKGTTLNWTLARGGEKRNIIPAEASAEADMRYSDPAESERVLADAR
KLTGERLVADTEVSLRLDKGRPPLVKNPASQRLAETAQTLYGRIGKRIEPIAMRFGTDAG
YAYVPGSDKPAVLETLGVVGAGLHSEAEYLELSSIAPRLYLTVALIRELSAD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074673
n/a
NameBDBM50074673
Synonyms:2-(3-Amino-phenylsulfanylcarbonylamino)-pentanedioic acid | CHEMBL177966
TypeSmall organic molecule
Emp. Form.C12H14N2O5S
Mol. Mass.298.315
SMILESNc1cccc(SC(=O)NC(CCC(O)=O)C(O)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: