Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM50075367
Substrate/Competitorn/a
Meas. Tech.ChEBML_197079
Kd 15±n/a nM
Citation Vuligonda VGarst MEChandraratna RA Stereoselective synthesis and receptor activity of conformationally defined retinoid X receptor selective ligands. Bioorg Med Chem Lett 9:589-94 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoid receptor
Synonyms:Nuclear receptor subfamily 2 group B member 2 | Retinoic acid receptor RXR-beta | Retinoid X receptor beta
Type:PROTEIN
Mol. Mass.:56932.89
Organism:Homo sapiens (Human)
Description:ChEMBL_39045
Residue:533
Sequence:
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYP
EQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50075367
n/a
NameBDBM50075367
Synonyms:(2E,4E)-3-Methyl-5-{2-[(E)-2-(2,6,6-trimethyl-cyclohex-1-enyl)-vinyl]-furan-3-yl}-penta-2,4-dienoic acid | CHEMBL347411
TypeSmall organic molecule
Emp. Form.C21H26O3
Mol. Mass.326.4293
SMILESC\C(\C=C\c1ccoc1\C=C\C1=C(C)CCCC1(C)C)=C/C(O)=O |c:12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: