Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetComplement C1r subcomponent
LigandBDBM50063698
Substrate/Competitorn/a
Meas. Tech.ChEMBL_48024
IC50 12000±n/a nM
Citation Plummer JSCai CHays SJGilmore JLEmmerling MRMichael WNarasimhan LSWatson MDWang KNath REvans LMJaen JC Benzenesulfonamide derivatives of 2-substituted 4H-3,1-benzoxazin-4-ones and benzthiazin-4-ones as inhibitors of complement C1r protease. Bioorg Med Chem Lett 9:815-20 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Complement C1r subcomponent
Name:Complement C1r
Synonyms:Complement C1r
Type:Enzyme
Mol. Mass.:80113.65
Organism:Homo sapiens (Human)
Description:P00736
Residue:705
Sequence:
MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVF
QQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGY
ELQEDTHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF
DIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQD
DGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSR
ESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVF
TNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRV
SVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVME
EKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAV
RDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50063698
n/a
NameBDBM50063698
Synonyms:4-Guanidino-benzoic acid 6-carbamimidoyl-naphthalen-2-yl ester | 4-Guanidino-benzoic acid 6-carbamimidoyl-naphthalen-2-yl ester(FUT-175) | CHEMBL273264
TypeSmall organic molecule
Emp. Form.C19H17N5O2
Mol. Mass.347.3706
SMILES[#7]\[#6](-[#7])=[#7]/c1ccc(cc1)-[#6](=O)-[#8]-c1ccc2cc(ccc2c1)-[#6](-[#7])=[#7]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: