Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStromelysin-1
LigandBDBM50076341
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104736
Ki 18±n/a nM
Citation Jacobsen EJMitchell MAHendges SKBelonga KLSkaletzky LLStelzer LSLindberg TJFritzen ELSchostarez HJO'Sullivan TJMaggiora LLStuchly CWLaborde ALKubicek MFPoorman RABeck JMMiller HRPetzold GLScott PSTruesdell SEWallace TLWilks JWFisher CGoodman LVKaytes PS Synthesis of a series of stromelysin-selective thiadiazole urea matrix metalloproteinase inhibitors. J Med Chem 42:1525-36 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Stromelysin-1
Name:Matrix metalloproteinase (2 and 3)
Synonyms:MMP-3 | Matrix metalloproteinase 3 | Matrix metalloproteinase-3 | Matrix metalloproteinase-3 (MMP-3) | Matrix metalloproteinase-3 (MMP3) | SL-1 | Stromelysin 1 | Transin-1
Type:Enzyme
Mol. Mass.:53973.13
Organism:Homo sapiens (Human)
Description:
Residue:477
Sequence:
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50076341
n/a
NameBDBM50076341
Synonyms:(S)-N-Methyl-3-pentafluorophenyl-2-[3-(5-thioxo-4,5-dihydro-[1,3,4]thiadiazol-2-yl)-ureido]-propionamide | 2-[3-(5-MERCAPTO-[1,3,4]THIADIAZOL-2YL)-UREIDO]-N-METHYL-3-PENTAFLUOROPHENYL-PROPIONAMIDE | CHEMBL290140 | PNU-142372
TypeSmall organic molecule
Emp. Form.C13H10F5N5O2S2
Mol. Mass.427.373
SMILESCNC(=O)[C@H](Cc1c(F)c(F)c(F)c(F)c1F)NC(=O)Nc1nnc(S)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: