Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50078087
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157707
pH6.2±n/a
Ki 0.110000±n/a nM
Commentsextracted
Citation Vara Prasad JVBoyer FEDomagala JMEllsworth ELGajda CHagen SEMarkoski LJTait BDLunney EATummino PJFerguson DHoller THupe DNouhan CGracheck SJVanderRoest SSaunders JIyer KSinz MBrodfuehrer J Nonpeptidic HIV protease inhibitors: 6-alkyl-5,6-dihydropyran-2-ones possessing achiral 3-(4-amino/carboxamide-2-t-butyl,5-methylphenyl thio) moiety: antiviral activities and pharmacokinetic properties. Bioorg Med Chem Lett 9:1481-6 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50078087
n/a
NameBDBM50078087
Synonyms:(S)-6-[2-(4-Amino-phenyl)-ethyl]-3-(2-tert-butyl-4-hydroxymethyl-5-methyl-phenylsulfanyl)-4-hydroxy-6-isopropyl-5,6-dihydro-pyran-2-one | 6-[2-(4-Amino-phenyl)-ethyl]-3-(2-tert-butyl-4-hydroxymethyl-5-methyl-phenylsulfanyl)-4-hydroxy-6-isopropyl-5,6-dihydro-pyran-2-one | CHEMBL285759 | CI-1029
TypeSmall organic molecule
Emp. Form.C28H37NO4S
Mol. Mass.483.663
SMILESCC(C)[C@]1(CCc2ccc(N)cc2)CC(=O)C(Sc2cc(C)c(CO)cc2C(C)(C)C)C(=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: