Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 1
LigandBDBM50078981
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143983
Ki 18±n/a nM
Citation Murakami YHara HOkada THashizume HKii MIshihara YIshikawa MShimamura MMihara SKato GHanasaki KHagishita SFujimoto M 1,3-Disubstituted benzazepines as novel, potent, selective neuropeptide Y Y1 receptor antagonists. J Med Chem 42:2621-32 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 1
Name:Neuropeptide Y receptor type 1
Synonyms:NPY-Y1 | NPY1-R | neuropeptide Y receptor Y1
Type:Enzyme Catalytic Domain
Mol. Mass.:44399.07
Organism:Homo sapiens (Human)
Description:NPY-Y1 NPY1R HUMAN::P25929
Residue:384
Sequence:
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDDNEKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50078981
n/a
NameBDBM50078981
Synonyms:1-(2,3-Dihydro-benzo[1,4]dioxin-6-yl)-3-{1-[3-(3-isopropyl-ureido)-benzyl]-2-oxo-2,3,4,5-tetrahydro-1H-benzo[b]azepin-3-yl}-urea | CHEMBL329997
TypeSmall organic molecule
Emp. Form.C30H33N5O5
Mol. Mass.543.6135
SMILESCC(C)NC(=O)Nc1cccc(CN2c3ccccc3CCC(NC(=O)Nc3ccc4OCCOc4c3)C2=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: