Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEDNRB
LigandBDBM50079426
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63846
Ki 3.21±n/a nM
Citation Amberg WHergenröder SHillen HJansen RKettschau GKling AKlinge DRaschack MRiechers HUnger L Discovery and synthesis of (S)-3-[2-(3,4-dimethoxyphenyl)ethoxy]-2- (4,6-dimethylpyrimidin-2-yloxy)-3,3-diphenylpropionic acid (LU 302872), a novel orally active mixed ET(A)/ET(B) receptor antagonist. J Med Chem 42:3026-32 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
EDNRB
Name:Endothelin receptor, ET-A/ET-B
Synonyms:ENDOTHELIN B | ET-B | Endothelin receptor ET-B | Endothelin receptor non-selective type | Endothelin receptor, ET-A/ET-B
Type:Enzyme Catalytic Domain
Mol. Mass.:49664.00
Organism:Homo sapiens (Human)
Description:ENDOTHELIN B EDNRB HUMAN::P24530
Residue:442
Sequence:
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079426
n/a
NameBDBM50079426
Synonyms:2-(4,6-Dimethyl-pyrimidin-2-yloxy)-3,3-diphenyl-3-[2-(3,4,5-trimethoxy-phenyl)-ethoxy]-propionic acid | CHEMBL103201
TypeSmall organic molecule
Emp. Form.C32H34N2O7
Mol. Mass.558.6216
SMILESCOc1cc(CCOC(C(Oc2nc(C)cc(C)n2)C(O)=O)(c2ccccc2)c2ccccc2)cc(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: