Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50079783 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_66269 |
---|
EC50 | 12±n/a nM |
---|
Citation | Armstrong, HM; Wong, F; Holmes, MA; Sinclair, PJ; Goulet, MT; Dumont, FJ; Staruch, MJ; Koprak, S; Peterson, LB; Rosa, R; Wilusz, MB; Wiederrecht, GJ; Cryan, JG; Wyvratt, MJ; Parsons, WH Potent immunosuppressive C32-O-arylethyl ether derivatives of ascomycin with reduced toxicity. Bioorg Med Chem Lett9:2089-94 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50079783 |
---|
n/a |
---|
Name | BDBM50079783 |
Synonyms: | 12-{2-[4-(2-Benzo[b]thiophen-2-yl-2-hydroxy-ethoxy)-3-methoxy-cyclohexyl]-1-methyl-vinyl}-17-ethyl-1,14-dihydroxy-23,25-dimethoxy-13,19,21,27-tetramethyl-11,28-dioxa-4-aza-tricyclo[22.3.1.0*4,9*]octacos-18-ene-2,3,10,16-tetraone | CHEMBL268110 |
Type | Small organic molecule |
Emp. Form. | C53H77NO13S |
Mol. Mass. | 968.242 |
SMILES | CC[C@@H]1\C=C(C)\C[C@H](C)C[C@H](OC)[C@H]2O[C@](O)([C@H](C)C[C@@H]2OC)C(=O)C(=O)N2CCCC[C@H]2C(=O)O[C@@H]([C@H](C)[C@H](O)CC1=O)C(\C)=C\C1CC[C@@H](OC[C@H](O)c2cc3ccccc3s2)[C@@H](C1)OC |c:3| |
Structure |
|