| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Ligand | BDBM50079777 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_66269 |
|---|
| EC50 | 0.900000±n/a nM |
|---|
| Citation |  Armstrong, HM; Wong, F; Holmes, MA; Sinclair, PJ; Goulet, MT; Dumont, FJ; Staruch, MJ; Koprak, S; Peterson, LB; Rosa, R; Wilusz, MB; Wiederrecht, GJ; Cryan, JG; Wyvratt, MJ; Parsons, WH Potent immunosuppressive C32-O-arylethyl ether derivatives of ascomycin with reduced toxicity. Bioorg Med Chem Lett9:2089-94 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
|---|
| Type: | Isomerase |
|---|
| Mol. Mass.: | 11953.09 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62942 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
|---|
| BDBM50079777 |
|---|
| n/a |
|---|
| Name | BDBM50079777 |
|---|
| Synonyms: | (E)-(1R,9S,12S,13R,14R,21S,23S,24R,25S,27R)-17-Allyl-1,14-dihydroxy-12-[(E)-2-((3R,4R)-4-hydroxy-3-methoxy-cyclohexyl)-1-methyl-vinyl]-23,25-dimethoxy-13,19,21,27-tetramethyl-11,28-dioxa-4-aza-tricyclo[22.3.1.0*4,9*]octacos-18-ene-2,3,10,16-tetraone | CHEMBL66247 | FK-506 | FR-900506 | Prograf | Protopic | Tacrolimus |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H69NO12 |
|---|
| Mol. Mass. | 804.0182 |
|---|
| SMILES | [H][C@]12O[C@](O)([C@H](C)C[C@@H]1OC)C(=O)C(=O)N1CCCC[C@@]1([H])C(=O)O[C@@H]([C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)\C=C(C)\C[C@H](C)C[C@@H]2OC)C(\C)=C\[C@@H]1CC[C@@H](O)[C@@H](C1)OC |c:39| |
|---|
| Structure | 
|
|---|
Search and Browse
