Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAromatase (CYP19)
LigandBDBM50079815
Substrate/Competitorn/a
Meas. Tech.ChEBML_36051
IC50 3000±n/a nM
Citation Vinh TKAhmadi MDelgado POPerez SFWalters HMSmith HJNicholls PJSimons C 1-[(Benzofuran-2-yl)phenylmethyl]-triazoles and -tetrazoles - potent competitive inhibitors of aromatase. Bioorg Med Chem Lett 9:2105-8 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aromatase (CYP19)
Name:Cytochrome P450 19A1
Synonyms:Aromatase | CYPXIX | Cytochrome P-450AROM | Cytochrome P450 19A1 | Cytochrome P450 2C19 | Cytochrome P450-C19 (CYP19) | Estrogen synthetase | FL cytokine receptor precursor | P-450AROM | Tyrosine Kinase FLT3
Type:Enzyme
Mol. Mass.:57888.92
Organism:Homo sapiens (Human)
Description:P11511
Residue:503
Sequence:
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079815
n/a
NameBDBM50079815
Synonyms:1-[(4-Chloro-phenyl)-(2,3-dihydro-benzofuran-2-yl)-methyl]-1H-tetrazole | CHEMBL294357
TypeSmall organic molecule
Emp. Form.C16H13ClN4O
Mol. Mass.312.754
SMILESClc1ccc(cc1)C(C1Cc2ccccc2O1)n1cnnn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: