| Reaction Details |
|---|
 | Report a problem with these data |
| Target | H2-K region expressed gene 2, rat orthologue |
|---|
| Ligand | BDBM50079821 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_103872 |
|---|
| IC50 | 3000±n/a nM |
|---|
| Citation |  Jones, AB; Acton, JJ; Rivetna, MN; Cummings, RT; Cubbon, RM; Nichols, EA; Schwartz, CD; Wicker, LS; Hermes, JD Tetrapeptide derived inhibitors of complexation of a class II MHC: the peptide backbone is not inviolate. Bioorg Med Chem Lett9:2109-14 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| H2-K region expressed gene 2, rat orthologue |
|---|
| Name: | H2-K region expressed gene 2, rat orthologue |
|---|
| Synonyms: | MHC class II | MHC class II region expressed gene KE2, isoform CRA_a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14499.39 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_10342 |
|---|
| Residue: | 127 |
|---|
| Sequence: | MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQN
AKAPGKA
|
|
|
|---|
| BDBM50079821 |
|---|
| n/a |
|---|
| Name | BDBM50079821 |
|---|
| Synonyms: | (1-(S)-1-Benzyl-2-{1-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-butylcarbamoyl]-4-guanidino-butylamino}-ethyl)-carbamic acid ethyl ester | CHEMBL64985 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H50N8O5 |
|---|
| Mol. Mass. | 590.7579 |
|---|
| SMILES | CCC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC[C@H](Cc1ccccc1)NC(=O)OCC)C(=O)N[C@@H](CC(C)C)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
