Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMHC class II
LigandBDBM50079827
Substrate/Competitorn/a
Meas. Tech.ChEBML_103872
IC50 320±n/a nM
Citation Jones ABActon JJRivetna MNCummings RTCubbon RMNichols EASchwartz CDWicker LSHermes JD Tetrapeptide derived inhibitors of complexation of a class II MHC: the peptide backbone is not inviolate. Bioorg Med Chem Lett 9:2109-14 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
MHC class II
Name:MHC class II
Synonyms:H2-K region expressed gene 2, rat orthologue | MHC class II region expressed gene KE2, isoform CRA_a
Type:PROTEIN
Mol. Mass.:14499.39
Organism:Rattus norvegicus
Description:ChEMBL_103872
Residue:127
Sequence:
MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQN
AKAPGKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079827
n/a
NameBDBM50079827
Synonyms:CHEMBL63981 | [(S)-1-((S)-1-{[(S)-1-((S)-1-Carbamoyl-3-methyl-butylcarbamoyl)-ethyl]-methyl-carbamoyl}-ethylcarbamoyl)-2-phenyl-ethyl]-carbamic acid ethyl ester
TypeSmall organic molecule
Emp. Form.C25H39N5O6
Mol. Mass.505.6071
SMILESCCOC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C)C(=O)N(C)[C@@H](C)C(=O)N[C@@H](CC(C)C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: