Reaction Details |
| Report a problem with these data |
Target | H2-K region expressed gene 2, rat orthologue |
---|
Ligand | BDBM50079831 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_103872 |
---|
IC50 | >50000±n/a nM |
---|
Citation | Jones, AB; Acton, JJ; Rivetna, MN; Cummings, RT; Cubbon, RM; Nichols, EA; Schwartz, CD; Wicker, LS; Hermes, JD Tetrapeptide derived inhibitors of complexation of a class II MHC: the peptide backbone is not inviolate. Bioorg Med Chem Lett9:2109-14 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
H2-K region expressed gene 2, rat orthologue |
---|
Name: | H2-K region expressed gene 2, rat orthologue |
Synonyms: | MHC class II | MHC class II region expressed gene KE2, isoform CRA_a |
Type: | PROTEIN |
Mol. Mass.: | 14499.39 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_10342 |
Residue: | 127 |
Sequence: | MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQN
AKAPGKA
|
|
|
BDBM50079831 |
---|
n/a |
---|
Name | BDBM50079831 |
Synonyms: | (S)-2-{(S)-2-[(R)-2-(3-Cyclohexyl-propylamino)-butyrylamino]-pentanoylamino}-4-methyl-pentanoic acid amide | CHEMBL63897 |
Type | Small organic molecule |
Emp. Form. | C24H46N4O3 |
Mol. Mass. | 438.647 |
SMILES | CCC[C@H](NC(=O)[C@@H](CC)NCCCC1CCCCC1)C(=O)N[C@@H](CC(C)C)C(N)=O |
Structure |
|