Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMHC class II
LigandBDBM50079844
Substrate/Competitorn/a
Meas. Tech.ChEMBL_103873
IC50 240±n/a nM
Citation Jones ABActon JJAdams ADYuen WNichols EASchwartz CDWicker LSHermes JD Tetrapeptide derived inhibitors of complexation of a class II MHC: fully unnatural ligands. Bioorg Med Chem Lett 9:2115-8 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
MHC class II
Name:MHC class II
Synonyms:H2-K region expressed gene 2, rat orthologue | MHC class II region expressed gene KE2, isoform CRA_a
Type:PROTEIN
Mol. Mass.:14499.39
Organism:Rattus norvegicus
Description:ChEMBL_103872
Residue:127
Sequence:
MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQN
AKAPGKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079844
n/a
NameBDBM50079844
Synonyms:CHEMBL66358 | N-Butyl-N'-{(S)-2-[(R)-3-(3-cyclohexyl-propylamino)-2-oxo-3-propyl-pyrrolidin-1-yl]-pentanoyl}-hydrazinecarboxylic acid ethyl ester
TypeSmall organic molecule
Emp. Form.C28H52N4O4
Mol. Mass.508.7369
SMILESCCCCN(NC(=O)[C@H](CCC)N1CC[C@@](CCC)(NCCCC2CCCCC2)C1=O)C(=O)OCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: