| Reaction Details |
|---|
 | Report a problem with these data |
| Target | H2-K region expressed gene 2, rat orthologue |
|---|
| Ligand | BDBM50079851 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_103873 (CHEMBL712990) |
|---|
| IC50 | >50000±n/a nM |
|---|
| Citation |  Jones, AB; Acton, JJ; Adams, AD; Yuen, W; Nichols, EA; Schwartz, CD; Wicker, LS; Hermes, JD Tetrapeptide derived inhibitors of complexation of a class II MHC: fully unnatural ligands. Bioorg Med Chem Lett9:2115-8 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| H2-K region expressed gene 2, rat orthologue |
|---|
| Name: | H2-K region expressed gene 2, rat orthologue |
|---|
| Synonyms: | MHC class II | MHC class II region expressed gene KE2, isoform CRA_a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14499.39 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_10342 |
|---|
| Residue: | 127 |
|---|
| Sequence: | MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQN
AKAPGKA
|
|
|
|---|
| BDBM50079851 |
|---|
| n/a |
|---|
| Name | BDBM50079851 |
|---|
| Synonyms: | CHEMBL441797 | N'-{(S)-2-[(R)-3-(3-Cyclohexyl-propylamino)-2-oxo-pyrrolidin-1-yl]-pentanoyl}-N-isobutyl-hydrazinecarboxylic acid amide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H43N5O3 |
|---|
| Mol. Mass. | 437.6192 |
|---|
| SMILES | CCC[C@H](N1CC[C@@H](NCCCC2CCCCC2)C1=O)C(=O)NN(CC(C)C)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
